Recombinant Human IL18 protein, His-tag, GMP Grade
- Specification
- Related Products
| Cat#: |
IL18-153THP |
| Common Name: |
IL18 |
| Product Name: |
Recombinant Human IL18 protein, His-tag, GMP Grade |
| Product Overview: |
Recombinant Human IL18 protein GMP Grade(NP_001230140), fused to His tag, was expressed in HEK293 Cells. |
| Source: |
HEK293 Cells |
| Species: |
Human |
| Tag : |
His |
| Form: |
Lyophilized. |
| Bio-activity: |
Measured by its ability to induce NFKB reporter gene expression in HEK 293 cell line.
The ED50 for this effect is typically 25.3 ng/mL. |
| AA Sequence: |
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTIS VKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKE RDLFKLILKKEDELGDRSIMFTVQNEDVDHHHHHH |
| Endotoxin: |
Less than 0.1EU/ug |
| Purity: |
Greater than 95% as determined by reducing SDS-PAGE. |
| Storage: |
Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
IL18 interleukin 18 (interferon-gamma-inducing factor) [ Homo sapiens ] |
| Official Symbol: |
IL18 |
| Synonyms: |
IL18; interleukin 18 (interferon-gamma-inducing factor); interleukin-18; IGIF; IL 1g; IL 18; IL1F4; IL-1 gamma; iboctadekin; interleukin-1 gamma; IFN-gamma-inducing factor; IL-18; IL-1g |
| GeneID: |
3606 |
| mRNA Refseq: |
NM_001243211 |
| Protein Refseq: |
NP_001230140 |
| MIM: |
600953 |
| UniProt ID: |
Q14116 |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
