Recombinant Human IL18 protein, His-tag, GMP Grade
- Specification
- Related Products
| Cat#: |
IL18-153THP |
| Common Name: |
IL18 |
| Product Name: |
Recombinant Human IL18 protein, His-tag, GMP Grade |
| Product Overview: |
Recombinant Human IL18 protein GMP Grade(NP_001230140), fused to His tag, was expressed in HEK293 Cells. |
| Source: |
HEK293 Cells |
| Species: |
Human |
| Tag : |
His |
| Form: |
Lyophilized. |
| Bio-activity: |
Measured by its ability to induce NFKB reporter gene expression in HEK 293 cell line.
The ED50 for this effect is typically 25.3 ng/mL. |
| AA Sequence: |
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTIS VKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKE RDLFKLILKKEDELGDRSIMFTVQNEDVDHHHHHH |
| Endotoxin: |
Less than 0.1EU/ug |
| Purity: |
Greater than 95% as determined by reducing SDS-PAGE. |
| Storage: |
Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
IL18 interleukin 18 (interferon-gamma-inducing factor) [ Homo sapiens ] |
| Official Symbol: |
IL18 |
| Synonyms: |
IL18; interleukin 18 (interferon-gamma-inducing factor); interleukin-18; IGIF; IL 1g; IL 18; IL1F4; IL-1 gamma; iboctadekin; interleukin-1 gamma; IFN-gamma-inducing factor; IL-18; IL-1g |
| GeneID: |
3606 |
| mRNA Refseq: |
NM_001243211 |
| Protein Refseq: |
NP_001230140 |
| MIM: |
600953 |
| UniProt ID: |
Q14116 |
Not For Human Consumption!
