Recombinant Human IL19 protein, GMP Grade
- Specification
- Related Products
| Cat#: |
IL19-4332THP |
| Common Name: |
IL19 |
| Product Name: |
Recombinant Human IL19 protein, GMP Grade |
| Product Overview: |
Recombinant Human IL19 protein GMP Grade(NP_715639) was expressed in E. coli. |
| Source: |
E. coli |
| Species: |
Human |
| Form: |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity: |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 1.5 ng/ml, corresponding to a specific activity of > 6.7 × 10^5 IU/mg. |
| Molecular Mass: |
Approximately 17.9 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids. |
| AA Sequence: |
LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA |
| Endotoxin: |
Less than 1 EU/µg determined by LAL method. |
| Purity: |
Greater than 95 % by SDS-PAGE and HPLC analyses. |
| Storage: |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
IL19 interleukin 19 [ Homo sapiens (human) ] |
| Official Symbol: |
IL19 |
| Synonyms: |
MDA1; NG.1; ZMDA1; IL-10C; Melanoma Differentiation-associated Protein-like Protein, NG.1 |
| GeneID: |
29949 |
| mRNA Refseq: |
NM_153758.2 |
| Protein Refseq: |
NP_715639.1 |
| MIM: |
605687 |
| UniProt ID: |
Q9UHD0 |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
