Recombinant Human IL19 protein, GMP Grade


Cat# Product Name Availability Size Price Qty
IL19-4332THP Recombinant Human IL19 protein, GMP Grade 10ug $998
Quote Order Bulk Order

  • Specification
  • Related Products
Cat#:  IL19-4332THP
Common Name:  IL19
Product Name:  Recombinant Human IL19 protein, GMP Grade
Product Overview:  Recombinant Human IL19 protein GMP Grade(NP_715639) was expressed in E. coli.
Source:  E. coli
Species:  Human
Form:  Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
Bio-activity:  Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 1.5 ng/ml, corresponding to a specific activity of > 6.7 × 10^5 IU/mg.
Molecular Mass:  Approximately 17.9 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
AA Sequence:  LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA
Endotoxin:  Less than 1 EU/µg determined by LAL method.
Purity:  Greater than 95 % by SDS-PAGE and HPLC analyses.
Storage:  This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles.
Reconstitution:  It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name:  IL19 interleukin 19 [ Homo sapiens (human) ]
Official Symbol:  IL19
Synonyms:  MDA1; NG.1; ZMDA1; IL-10C; Melanoma Differentiation-associated Protein-like Protein, NG.1
GeneID:  29949
mRNA Refseq:  NM_153758.2
Protein Refseq:  NP_715639.1
MIM:  605687
UniProt ID:  Q9UHD0
Catalog# Product Name Inquiry
EPO-01THP Recombinant Human Erythropoietin, GMP Grade Inquiry
BMP2-01THP Recombinant Human BMP2 protein, GMP Grade Inquiry
p65-01THP Recombinant HIV-1 p65 Protein, GMP Grade Inquiry
gp160-02THP Recombinant HIV-1 gp160 Protein, GMP Grade Inquiry
gp41-03THP Recombinant HIV-1 gp41 Protein, GMP Grade Inquiry


Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.