Recombinant Human IL20 protein, GMP Grade


Cat# Product Name Availability Size Price Qty
IL20-4333THP Recombinant Human IL20 protein, GMP Grade 10ug $998
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  IL20-4333THP
Common Name:  IL20
Product Name:  Recombinant Human IL20 protein, GMP Grade
Product Overview:  Recombinant Human IL20 protein GMP Grade(NP_061194) was expressed in E. coli.
Source:  E. coli
Species:  Human
Form:  Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.2, with trehalose.
Bio-activity:  Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10^6 IU/mg.
Molecular Mass:  Approximately 17.6 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
AA Sequence:  MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Endotoxin:  Less than 1 EU/µg determined by LAL method.
Purity:  Greater than 95 % by SDS-PAGE and HPLC analyses.
Storage:  This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles.
Reconstitution:  It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name:  IL20 interleukin 20 [ Homo sapiens ]
Official Symbol:  IL20
Synonyms:  IL20; interleukin 20; interleukin-20; IL 20; IL10D; ZCYTO10; cytokine Zcyto10; four alpha helix cytokine; IL-20; MGC96907;
GeneID:  50604
mRNA Refseq:  NM_018724
Protein Refseq:  NP_061194
MIM:  605619
UniProt ID:  Q9NYY1
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.