Recombinant Human IL20 protein, GMP Grade
- Specification
- Related Products
| Cat#: |
IL20-4333THP |
| Common Name: |
IL20 |
| Product Name: |
Recombinant Human IL20 protein, GMP Grade |
| Product Overview: |
Recombinant Human IL20 protein GMP Grade(NP_061194) was expressed in E. coli. |
| Source: |
E. coli |
| Species: |
Human |
| Form: |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.2, with trehalose. |
| Bio-activity: |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10^6 IU/mg. |
| Molecular Mass: |
Approximately 17.6 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids. |
| AA Sequence: |
MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE |
| Endotoxin: |
Less than 1 EU/µg determined by LAL method. |
| Purity: |
Greater than 95 % by SDS-PAGE and HPLC analyses. |
| Storage: |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
IL20 interleukin 20 [ Homo sapiens ] |
| Official Symbol: |
IL20 |
| Synonyms: |
IL20; interleukin 20; interleukin-20; IL 20; IL10D; ZCYTO10; cytokine Zcyto10; four alpha helix cytokine; IL-20; MGC96907; |
| GeneID: |
50604 |
| mRNA Refseq: |
NM_018724 |
| Protein Refseq: |
NP_061194 |
| MIM: |
605619 |
| UniProt ID: |
Q9NYY1 |
Not For Human Consumption!
