Recombinant Human IL22 protein, GMP Grade
- Specification
- Related Products
| Cat#: |
IL22-4335THP |
| Common Name: |
IL22 |
| Product Name: |
Recombinant Human IL22 protein, GMP Grade |
| Product Overview: |
Recombinant Human IL22 protein GMP Grade(NP_065386) was expressed in E. coli. |
| Source: |
E. coli |
| Species: |
Human |
| Form: |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 5.0. |
| Bio-activity: |
Fully biologically active when compared to standard. The ED50 as determined by inducing IL-10 secretion of human COLO 205 cells is less than 0.3 ng/ml, corresponding to a specific activity of > 3.3 × 10^6 IU/mg. |
| Molecular Mass: |
Approximately 33.6 kDa, non-disulfide-linked homodimeric protein containing of two 147 amino acid polypeptide chains. |
| AA Sequence: |
MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
| Endotoxin: |
Less than 1 EU/µg determined by LAL method. |
| Purity: |
Greater than 97 % by SDS-PAGE and HPLC analyses. |
| Storage: |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
IL22 interleukin 22 [ Homo sapiens ] |
| Official Symbol: |
IL22 |
| Synonyms: |
IL22; interleukin 22; interleukin-22; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; ILTIF; MGC79382; MGC79384; TIFa; TIFIL 23; zcyto18; cytokine Zcyto18; IL-10-related T-cell-derived inducible factor; IL-10-related T-cell-derived-inducible factor; IL-21; IL-22; IL-TIF; IL-D110; TIFIL-23; |
| GeneID: |
50616 |
| mRNA Refseq: |
NM_020525 |
| Protein Refseq: |
NP_065386 |
| MIM: |
605330 |
| UniProt ID: |
Q9GZX6 |
Not For Human Consumption!
