Recombinant Human IL33 protein, GMP Grade
- Specification
- Related Products
| Cat#: |
IL33-4337THP |
| Common Name: |
IL33 |
| Product Name: |
Recombinant Human IL33 protein, GMP Grade |
| Product Overview: |
Recombinant Human IL33 protein GMP Grade(NP_001186569) was expressed in E. coli. |
| Source: |
E. coli |
| Species: |
Human |
| Form: |
Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, 150 mM NaCl, 1 mM EDTA, 2 mM β-Mercaptoethanol, pH 7.4. |
| Bio-activity: |
The ED50 determined by a cell proliferation assay using murine D10S cells is less than 0.05 ng/mL, corresponding to a specific activity of >2.0 × 10^7 IU/mg. |
| Molecular Mass: |
Approximately 17.9 kDa, a single non-glycosylated polypeptide chain containing 159 amino acids. |
| AA Sequence: |
SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET |
| Endotoxin: |
Less than 1 EU/μg determined by LAL method. |
| Purity: |
Greater than 97% by SDS-PAGE and HPLC analyses. |
| Storage: |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw centigrade centigradeles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
IL33 interleukin 33 [ Homo sapiens ] |
| Official Symbol: |
IL33 |
| Synonyms: |
IL33; interleukin 33; C9orf26, chromosome 9 open reading frame 26 (NF HEV); interleukin-33; DKFZp586H0523; DVS27; DVS27 related protein; IL1F11; interleukin 1 family; member 11; NF HEV; nuclear factor for high endothelial venules; IL-33; IL-1F11; DVS27-related protein; interleukin-1 family member 11; nuclear factor from high endothelial venules; NF-HEV; NFEHEV; C9orf26; RP11-575C20.2; |
| GeneID: |
90865 |
| mRNA Refseq: |
NM_001199640 |
| Protein Refseq: |
NP_001186569 |
| MIM: |
608678 |
| UniProt ID: |
O95760 |
Not For Human Consumption!
