Recombinant Human IL36A protein, GMP Grade


Cat# Product Name Availability Size Price Qty
IL36A-4338THP Recombinant Human IL36A protein, GMP Grade 10ug $998
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  IL36A-4338THP
Common Name:  IL36A
Product Name:  Recombinant Human IL36A protein, GMP Grade
Product Overview:  Recombinant Human IL36A protein GMP Grade(NP_055255) was expressed in E. coli.
Source:  E. coli
Species:  Human
Form:  Lyophilized from a 0.2 μm filtered concentrated solution in 2 × PBS, pH 7.4.
Bio-activity:  Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rHuIL-36α at 1 µg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 µg/mL.
Molecular Mass:  Approximately 17.7 kDa, a single non-glycosylated polypeptide chain containing 158 amino acids.
AA Sequence:  MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Endotoxin:  Less than 1 EU/μg determined by LAL method.
Purity:  Greater than 95 % by SDS-PAGE and HPLC analyses.
Storage:  This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw centigrade centigradeles.
Reconstitution:  It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name:  IL36A interleukin 36, alpha [ Homo sapiens (human) ]
Official Symbol:  IL36A
Synonyms:  FIL1; FIL1E; IL1F6; IL-1F6; IL1(EPSILON); FIL1(EPSILON)
GeneID:  27179
mRNA Refseq:  NM_014440.2
Protein Refseq:  NP_055255.1
MIM:  605509
UniProt ID:  Q9UHA7
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.