Recombinant Human IL36A protein, GMP Grade
- Specification
- Related Products
| Cat#: |
IL36A-4338THP |
| Common Name: |
IL36A |
| Product Name: |
Recombinant Human IL36A protein, GMP Grade |
| Product Overview: |
Recombinant Human IL36A protein GMP Grade(NP_055255) was expressed in E. coli. |
| Source: |
E. coli |
| Species: |
Human |
| Form: |
Lyophilized from a 0.2 μm filtered concentrated solution in 2 × PBS, pH 7.4. |
| Bio-activity: |
Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rHuIL-36α at 1 µg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 µg/mL. |
| Molecular Mass: |
Approximately 17.7 kDa, a single non-glycosylated polypeptide chain containing 158 amino acids. |
| AA Sequence: |
MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF |
| Endotoxin: |
Less than 1 EU/μg determined by LAL method. |
| Purity: |
Greater than 95 % by SDS-PAGE and HPLC analyses. |
| Storage: |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw centigrade centigradeles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
IL36A interleukin 36, alpha [ Homo sapiens (human) ] |
| Official Symbol: |
IL36A |
| Synonyms: |
FIL1; FIL1E; IL1F6; IL-1F6; IL1(EPSILON); FIL1(EPSILON) |
| GeneID: |
27179 |
| mRNA Refseq: |
NM_014440.2 |
| Protein Refseq: |
NP_055255.1 |
| MIM: |
605509 |
| UniProt ID: |
Q9UHA7 |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
