Recombinant Human IL36A protein, GMP Grade
- Specification
- Related Products
| Cat#: |
IL36A-4338THP |
| Common Name: |
IL36A |
| Product Name: |
Recombinant Human IL36A protein, GMP Grade |
| Product Overview: |
Recombinant Human IL36A protein GMP Grade(NP_055255) was expressed in E. coli. |
| Source: |
E. coli |
| Species: |
Human |
| Form: |
Lyophilized from a 0.2 μm filtered concentrated solution in 2 × PBS, pH 7.4. |
| Bio-activity: |
Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rHuIL-36α at 1 µg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 µg/mL. |
| Molecular Mass: |
Approximately 17.7 kDa, a single non-glycosylated polypeptide chain containing 158 amino acids. |
| AA Sequence: |
MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF |
| Endotoxin: |
Less than 1 EU/μg determined by LAL method. |
| Purity: |
Greater than 95 % by SDS-PAGE and HPLC analyses. |
| Storage: |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw centigrade centigradeles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
IL36A interleukin 36, alpha [ Homo sapiens (human) ] |
| Official Symbol: |
IL36A |
| Synonyms: |
FIL1; FIL1E; IL1F6; IL-1F6; IL1(EPSILON); FIL1(EPSILON) |
| GeneID: |
27179 |
| mRNA Refseq: |
NM_014440.2 |
| Protein Refseq: |
NP_055255.1 |
| MIM: |
605509 |
| UniProt ID: |
Q9UHA7 |
Not For Human Consumption!
