Recombinant Human IL7 protein, GMP Grade


Cat# Product Name Availability Size Price Qty
IL8-4323THP Recombinant Human IL7 protein, GMP Grade 10ug $998
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  IL8-4323THP
Common Name:  IL8
Product Name:  Recombinant Human IL7 protein, GMP Grade
Product Overview:  Recombinant Human IL7 protein GMP Grade(NP_000575) was expressed in E. coli.
Source:  E. coli
Species:  Human
Form:  Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
Bio-activity:  Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human CXCR2 transfected mouse BaF3 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10^5 IU/mg.
Molecular Mass:  Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 72 amino acids.
AA Sequence:  SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Endotoxin:  Less than 1 EU/µg determined by LAL method.
Purity:  Greater than 97 % by SDS-PAGE and HPLC analyses.
Storage:  This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles.
Reconstitution:  It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name:  CXCL8 chemokine (C-X-C motif) ligand 8 [ Homo sapiens ]
Official Symbol:  IL8
Synonyms:  IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; 4q13-q21; interleukin-8; emoctakin; interleukin 8; T-cell chemotactic factor; neutrophil-activating peptide 1; beta-thromboglobulin-like protein; granulocyte chemotactic protein 1; tumor necrosis factor-induced gene 1; alveolar macrophage chemotactic factor I; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; small inducible cytokine subfamily B, member 8; lymphocyte derived neutrophil activating peptide; lung giant cell carcinoma-derived chemotactic protein; beta endothelial cell-derived neutrophil activating peptide
GeneID:  3576
mRNA Refseq:  NM_000584
Protein Refseq:  NP_000575
MIM:  146930
UniProt ID:  P10145
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.