| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| IL8-4323THP | Recombinant Human IL7 protein, GMP Grade | 10ug | $998 |
|
|
| Quote Order Bulk Order | |||||
| Cat#: | IL8-4323THP |
| Common Name: | IL8 |
| Product Name: | Recombinant Human IL7 protein, GMP Grade |
| Product Overview: | Recombinant Human IL7 protein GMP Grade(NP_000575) was expressed in E. coli. |
| Source: | E. coli |
| Species: | Human |
| Form: | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity: | Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human CXCR2 transfected mouse BaF3 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10^5 IU/mg. |
| Molecular Mass: | Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 72 amino acids. |
| AA Sequence: | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Endotoxin: | Less than 1 EU/µg determined by LAL method. |
| Purity: | Greater than 97 % by SDS-PAGE and HPLC analyses. |
| Storage: | This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles. |
| Reconstitution: | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: | CXCL8 chemokine (C-X-C motif) ligand 8 [ Homo sapiens ] |
| Official Symbol: | IL8 |
| Synonyms: | IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; 4q13-q21; interleukin-8; emoctakin; interleukin 8; T-cell chemotactic factor; neutrophil-activating peptide 1; beta-thromboglobulin-like protein; granulocyte chemotactic protein 1; tumor necrosis factor-induced gene 1; alveolar macrophage chemotactic factor I; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; small inducible cytokine subfamily B, member 8; lymphocyte derived neutrophil activating peptide; lung giant cell carcinoma-derived chemotactic protein; beta endothelial cell-derived neutrophil activating peptide |
| GeneID: | 3576 |
| mRNA Refseq: | NM_000584 |
| Protein Refseq: | NP_000575 |
| MIM: | 146930 |
| UniProt ID: | P10145 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| EPO-01THP | Recombinant Human Erythropoietin, GMP Grade | Inquiry |
| BMP2-01THP | Recombinant Human BMP2 protein, GMP Grade | Inquiry |
| p65-01THP | Recombinant HIV-1 p65 Protein, GMP Grade | Inquiry |
| gp160-02THP | Recombinant HIV-1 gp160 Protein, GMP Grade | Inquiry |
| gp41-03THP | Recombinant HIV-1 gp41 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools