Recombinant Human IL7 protein, His-tag, GMP Grade
- Specification
- Related Products
| Cat#: |
IL7-151THP |
| Common Name: |
IL7 |
| Product Name: |
Recombinant Human IL7 protein, His-tag, GMP Grade |
| Product Overview: |
Recombinant Human IL7 protein GMP Grade(NP_000871), fused to His tag, was expressed in HEK293 Cells. |
| Source: |
HEK293 Cells |
| Species: |
Human |
| Tag : |
His |
| Form: |
Lyophilized. |
| Bio-activity: |
2x10^6U/mg |
| AA Sequence: |
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQ FLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCF LKRLLQEIKTCWNKILMGTKEHVDHHHHHH |
| Endotoxin: |
Less than 0.1EU/ug |
| Purity: |
Greater than 95% as determined by reducing SDS-PAGE. |
| Storage: |
Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Reconstitution: |
Recommemnd working concentration: 40ng/ml |
| Gene Name: |
IL7 interleukin 7 [ Homo sapiens ] |
| Official Symbol: |
IL7 |
| Synonyms: |
IL7; interleukin 7; interleukin-7; IL 7; IL-7 |
| GeneID: |
3574 |
| mRNA Refseq: |
NM_000880 |
| Protein Refseq: |
NP_000871 |
| MIM: |
146660 |
| UniProt ID: |
P13232 |
Not For Human Consumption!
