Recombinant Human KITLG protein, GMP Grade
- Specification
- Related Products
| Cat#: |
KITLG-4339THP |
| Common Name: |
KITLG |
| Product Name: |
Recombinant Human KITLG protein, GMP Grade |
| Product Overview: |
Recombinant Human KITLG protein GMP Grade(NP_000890) was expressed in E. coli. |
| Source: |
E. coli |
| Species: |
Human |
| Form: |
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity: |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10^5 IU/mg. |
| Molecular Mass: |
Approximately 18.5 kDa, a single non-glycosylated polypeptide chain containing 164 amino acids. |
| AA Sequence: |
EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA |
| Endotoxin: |
Less than 1 EU/μg determined by LAL method. |
| Purity: |
Greater than 97 % by SDS-PAGE and HPLC analyses. |
| Storage: |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw centigrade centigradeles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
KITLG KIT ligand [ Homo sapiens ] |
| Official Symbol: |
KITLG |
| Synonyms: |
KITLG; KIT ligand; MGF; kit ligand; familial progressive hyperpigmentation 2; FPH2; Kitl; KL 1; mast cell growth factor; SCF; SF; steel factor; stem cell factor; c-Kit ligand; KL-1; SHEP7; kit-ligand; DKFZp686F2250; |
| GeneID: |
4254 |
| mRNA Refseq: |
NM_000899 |
| Protein Refseq: |
NP_000890 |
| MIM: |
184745 |
| UniProt ID: |
P21583 |
Not For Human Consumption!
