Recombinant Human LIF protein, GMP Grade


Cat# Product Name Availability Size Price Qty
LIF-4343THP Recombinant Human LIF protein, GMP Grade 10ug $998
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  LIF-4343THP
Common Name:  LIF
Product Name:  Recombinant Human LIF protein, GMP Grade
Product Overview:  Recombinant Human LIF protein GMP Grade(NP_001244064) was expressed in E. coli.
Source:  E. coli
Species:  Human
Form:  Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4
Bio-activity:  Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent proliferation of human TF-1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10^7 IU/mg.
Molecular Mass:  Approximately 19.7 kDa, a single non-glycosylated polypeptide chain containing 180 amino acids.
AA Sequence:  SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Endotoxin:  Less than 1 EU/μg determined by LAL method.
Purity:  Greater than 98% by SDS-PAGE and HPLC analyses.
Storage:  This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw centigrade centigradeles.
Reconstitution:  It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name:  LIF leukemia inhibitory factor [ Homo sapiens ]
Official Symbol:  LIF
Synonyms:  LIF; leukemia inhibitory factor; CDF; cholinergic differentiation factor; DIA; differentiation inhibitory activity; differentiation inducing factor; hepatocyte stimulating factor III; HILDA; human interleukin in DA cells; D factor; melanoma-derived LPL inhibitor; differentiation-inducing factor; hepatocyte-stimulating factor III; differentiation-stimulating factor; MLPLI;
GeneID:  3976
mRNA Refseq:  NM_001257135
Protein Refseq:  NP_001244064
MIM:  159540
UniProt ID:  P15018
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Fluor Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.