Recombinant Human LIF protein, GMP Grade
- Specification
- Related Products
| Cat#: |
LIF-4343THP |
| Common Name: |
LIF |
| Product Name: |
Recombinant Human LIF protein, GMP Grade |
| Product Overview: |
Recombinant Human LIF protein GMP Grade(NP_001244064) was expressed in E. coli. |
| Source: |
E. coli |
| Species: |
Human |
| Form: |
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4 |
| Bio-activity: |
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent proliferation of human TF-1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10^7 IU/mg. |
| Molecular Mass: |
Approximately 19.7 kDa, a single non-glycosylated polypeptide chain containing 180 amino acids. |
| AA Sequence: |
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF |
| Endotoxin: |
Less than 1 EU/μg determined by LAL method. |
| Purity: |
Greater than 98% by SDS-PAGE and HPLC analyses. |
| Storage: |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw centigrade centigradeles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
LIF leukemia inhibitory factor [ Homo sapiens ] |
| Official Symbol: |
LIF |
| Synonyms: |
LIF; leukemia inhibitory factor; CDF; cholinergic differentiation factor; DIA; differentiation inhibitory activity; differentiation inducing factor; hepatocyte stimulating factor III; HILDA; human interleukin in DA cells; D factor; melanoma-derived LPL inhibitor; differentiation-inducing factor; hepatocyte-stimulating factor III; differentiation-stimulating factor; MLPLI; |
| GeneID: |
3976 |
| mRNA Refseq: |
NM_001257135 |
| Protein Refseq: |
NP_001244064 |
| MIM: |
159540 |
| UniProt ID: |
P15018 |
Not For Human Consumption!
