Recombinant Human TGFB1 protein, GMP Grade
- Specification
- Related Products
| Cat#: |
TGFB1-159THP |
| Common Name: |
TGFB1 |
| Product Name: |
Recombinant Human TGFB1 protein, GMP Grade |
| Product Overview: |
Recombinant Human TGFB1 protein GMP Grade(NP_000651) was expressed in HEK293 Cells. |
| Source: |
HEK293 Cells |
| Species: |
Human |
| Form: |
Lyophilized. |
| Bio-activity: |
>2.0x10^7 U/mg |
| AA Sequence: |
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALY NQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Endotoxin: |
Less than 0.1EU/ug |
| Purity: |
Greater than 95% as determined by reducing SDS-PAGE. |
| Storage: |
Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: |
TGFB1 transforming growth factor, beta 1 [ Homo sapiens ] |
| Official Symbol: |
TGFB1 |
| Synonyms: |
TGFB1; transforming growth factor, beta 1; DPD1, TGFB; transforming growth factor beta-1; Camurati Engelmann disease; CED; TGFbeta; TGF-beta-1; TGF-beta 1 protein; LAP; DPD1; TGFB |
| GeneID: |
7040 |
| mRNA Refseq: |
NM_000660 |
| Protein Refseq: |
NP_000651 |
| MIM: |
190180 |
| UniProt ID: |
P01137 |
Not For Human Consumption!
