Recombinant Human TGFB1 protein, GMP Grade


Cat# Product Name Availability Size Price Qty
TGFB1-159THP Recombinant Human TGFB1 protein, GMP Grade 10ug $998
Quote Order Bulk Order

  • Specification
  • Related Products
  • Customer Review
  • Q&As
Cat#:  TGFB1-159THP
Common Name:  TGFB1
Product Name:  Recombinant Human TGFB1 protein, GMP Grade
Product Overview:  Recombinant Human TGFB1 protein GMP Grade(NP_000651) was expressed in HEK293 Cells.
Source:  HEK293 Cells
Species:  Human
Form:  Lyophilized.
Bio-activity:  >2.0x10^7 U/mg
AA Sequence:  ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALY NQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Endotoxin:  Less than 0.1EU/ug
Purity:  Greater than 95% as determined by reducing SDS-PAGE.
Storage:  Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Reconstitution:  It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name:  TGFB1 transforming growth factor, beta 1 [ Homo sapiens ]
Official Symbol:  TGFB1
Synonyms:  TGFB1; transforming growth factor, beta 1; DPD1, TGFB; transforming growth factor beta-1; Camurati Engelmann disease; CED; TGFbeta; TGF-beta-1; TGF-beta 1 protein; LAP; DPD1; TGFB
GeneID:  7040
mRNA Refseq:  NM_000660
Protein Refseq:  NP_000651
MIM:  190180
UniProt ID:  P01137
Customer Reviews (0)
No reviews available yet.
Write a Review
Q&As (0)
No Q&A available yet.
Ask a question


Not For Human Consumption!

My Review for

Required fields are marked with *

Overall Rating *
×

Ask a Question for

Required fields are marked with *

×

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

Menu

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0
Inquiry Basket
Copyright © Creative BioMart. All Rights Reserved.