- Home
- Products
- Services
- Applications
- Resource
- Company
| Cat# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| TGFB1-159THP | Recombinant Human TGFB1 protein, GMP Grade | 10ug | $998 |
|
|
| Quote Order Bulk Order | |||||
| Cat#: | TGFB1-159THP |
| Common Name: | TGFB1 |
| Product Name: | Recombinant Human TGFB1 protein, GMP Grade |
| Product Overview: | Recombinant Human TGFB1 protein GMP Grade(NP_000651) was expressed in HEK293 Cells. |
| Source: | HEK293 Cells |
| Species: | Human |
| Form: | Lyophilized. |
| Bio-activity: | >2.0x10^7 U/mg |
| AA Sequence: | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALY NQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Endotoxin: | Less than 0.1EU/ug |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage: | Lyophilized and reconstituted protein should be stored at -80 °C. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Reconstitution: | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name: | TGFB1 transforming growth factor, beta 1 [ Homo sapiens ] |
| Official Symbol: | TGFB1 |
| Synonyms: | TGFB1; transforming growth factor, beta 1; DPD1, TGFB; transforming growth factor beta-1; Camurati Engelmann disease; CED; TGFbeta; TGF-beta-1; TGF-beta 1 protein; LAP; DPD1; TGFB |
| GeneID: | 7040 |
| mRNA Refseq: | NM_000660 |
| Protein Refseq: | NP_000651 |
| MIM: | 190180 |
| UniProt ID: | P01137 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| EPO-01THP | Recombinant Human Erythropoietin, GMP Grade | Inquiry |
| BMP2-01THP | Recombinant Human BMP2 protein, GMP Grade | Inquiry |
| p65-01THP | Recombinant HIV-1 p65 Protein, GMP Grade | Inquiry |
| gp160-02THP | Recombinant HIV-1 gp160 Protein, GMP Grade | Inquiry |
| gp41-03THP | Recombinant HIV-1 gp41 Protein, GMP Grade | Inquiry |
Not For Human Consumption!
